TAZ mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TAZ mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TAZ mouse monoclonal antibody,clone OTI5A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TAZ mouse monoclonal antibody,clone OTI5A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TAZ mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TAZ mouse monoclonal antibody,clone OTI5A4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TAZ mouse monoclonal antibody,clone OTI5A4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TAZ mouse monoclonal antibody,clone OTI1B3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TAZ mouse monoclonal antibody,clone OTI1B3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-TAZ Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ |
Goat Polyclonal Antibody against Tafazzin
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HLKTQAEQLHNH, from the C Terminus of the protein sequence according to NP_000107.1; NP_851828.1; NP_851829.1; NP_851830.1. |
TAZ mouse monoclonal antibody,clone OTI5A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TAZ mouse monoclonal antibody,clone OTI1B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".