Antibodies

Jump to Filters
View as table Download
Nestin (NES) Rabbit Polyclonal Antibody
TA344204

USD 539.00

5 Days

Rabbit Polyclonal Anti-NES Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NES antibody: synthetic peptide directed towards the middle region of human NES. Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
Nestin (NES) Rabbit Polyclonal Antibody
TA310068

USD 285.00

3 Weeks

Rabbit anti-NES polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human Nestin