Rabbit Polyclonal Anti-UBQLN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBQLN1 |
Rabbit Polyclonal Anti-UBQLN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBQLN1 |
Rabbit Polyclonal Antibody against UBQLN1 (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This Ubiquilin1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 296-326 amino acids from the Central region of human Ubiquilin1. |
Rabbit Polyclonal Anti-UBQLN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBQLN1 antibody: synthetic peptide directed towards the middle region of human UBQLN1. Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA |
Rabbit polyclonal antibody to Ubiquilin-1 (ubiquilin 1)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 64 and 345 of Ubiquilin-1 (Uniprot ID#Q9UMX0) |
Rabbit polyclonal Ubiquilin1 (PLIC1) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This Ubiquilin1 (PLIC1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-49 amino acids from the N-terminal region of human Ubiquilin1 (PLIC1). |
Rabbit Polyclonal Antibody against UBQLN1 (N-term)
Applications | WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This Ubiquilin1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-70 amino acids from the N-terminal region of human Ubiquilin1. |