Antibodies

Jump to Filters
View as table Download
Kv4.2 (KCND2) (N-term) Rabbit Polyclonal Antibody
AP52303PU-N

USD 580.00

2 Weeks

Kv4.2 (KCND2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 122-151 amino acids from the N-terminal region of human KCND2
Kv4.2 (KCND2) Rabbit Polyclonal Antibody
TA338567

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCND2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCND2 antibody: synthetic peptide directed towards the middle region of human KCND2. Synthetic peptide located within the following region: RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL