Antibodies

Jump to Filters
View as table Download
Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody
AP23069PU-N

USD 555.00

2 Weeks

Carbonic Anhydrase I (CA1) (166-176) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human CA1 / Carbonic Anhydrase I (NP_001729.1)
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA313537

USD 380.00

In Stock

Rabbit polyclonal anti-CA1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA1.
Carbonic Anhydrase I (CA1) (N-term) Rabbit Polyclonal Antibody
AP50693PU-N

USD 580.00

2 Weeks

Carbonic Anhydrase I (CA1) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 67-98 amino acids from the N-terminal region of human CA1
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA344346

USD 539.00

5 Days

Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226AF-N

USD 330.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226BT-N

USD 540.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226PU-N

USD 705.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA323825

USD 380.00

In Stock

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA323826

USD 380.00

In Stock

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase I (CA1) Goat Polyclonal Antibody
TA305634

USD 520.00

5 Days

Goat Anti-CA1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAIKTKGKRAP, from the internal region of the protein sequence according to NP_001729.1.
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA326896

USD 365.00

In Stock

Rabbit anti-CA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CA1