Antibodies

Jump to Filters
View as table Download
Archaemetzincin 2 (AMZ2) Rabbit Polyclonal Antibody
TA349498

USD 380.00

In Stock

Rabbit Polyclonal Anti-AMZ2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AMZ2
Archaemetzincin 2 (AMZ2) Rabbit Polyclonal Antibody
AP45678PU-N

USD 430.00

2 Weeks

Archaemetzincin 2 (AMZ2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards an internal region of rat AMZ2
Archaemetzincin 2 (AMZ2) Rabbit Polyclonal Antibody
TA336023

USD 539.00

5 Days

Rabbit Polyclonal Anti-AMZ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMZ2 Antibody: synthetic peptide directed towards the C terminal of human AMZ2. Synthetic peptide located within the following region: ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE