Antibodies

View as table Download

DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated

DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

DDB2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDB2

Rabbit Polyclonal Anti-DDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF

DDB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DDB2