Antibodies

View as table Download

Sphingomyelin Synthase 2 (SGMS2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the Human Sphingomyelin Synthase 2 protein

Sphingomyelin Synthase 2 (SGMS2) rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the human sphingomyelin synthase 2 protein.

Rabbit Polyclonal Anti-SGMS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2.

Rabbit Polyclonal Anti-SGMS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY