Goat Anti-PP2A / PPP2R1A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2. |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Germany
Japan
United Kingdom
China
