Antibodies

View as table Download

GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated

GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), Biotinylated

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Biotin

GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), HRP conjugated

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation HRP

GCLC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 6-34 amino acids from the N-terminal region of Human GCLC / GLCLC

GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-GCLC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLC antibody: synthetic peptide directed towards the N terminal of human GCLC. Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Rabbit Polyclonal Anti-GCLC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLC antibody: synthetic peptide directed towards the middle region of human GCLC. Synthetic peptide located within the following region: RISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQEGIDHLLAQHVA