Antibodies

View as table Download

Anti-CKM Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle

Rabbit polyclonal anti-CKM / M-CK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.

Creatine kinase M type (CKM) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human Creatine Kinase M.

Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2.

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI

Creatine kinase M type (CKM) mouse monoclonal antibody, clone 027-17186, Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Creatine kinase M type (CKM) goat polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Purified CK-MM from human skeletal muscle