Antibodies

View as table Download

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN