Rabbit Polyclonal Anti-TRDMT1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRDMT1 |
Rabbit Polyclonal Anti-TRDMT1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRDMT1 |
Rabbit Polyclonal Anti-TRDMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV |