Antibodies

View as table Download

Rabbit polyclonal anti-AOX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOX1

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NAMPT Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NAMPT

Goat Anti-CD38 (aa226-237) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EVHNLQPEKVQT, from the internal region of the protein sequence according to NP_001766.2.

Rabbit Polyclonal Anti-PBEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Rabbit anti CD38 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated