Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CREBZF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREBZF antibody: synthetic peptide directed towards the C terminal of human CREBZF. Synthetic peptide located within the following region: TSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCS |
Rabbit Polyclonal Anti-CREBZF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREBZF antibody: synthetic peptide directed towards the middle region of human CREBZF. Synthetic peptide located within the following region: GLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVS |
Rabbit Polyclonal Anti-Crebzf Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Crebzf antibody is: synthetic peptide directed towards the C-terminal region of Rat Crebzf. Synthetic peptide located within the following region: KRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDH |
Rabbit Polyclonal Anti-CREBZF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREBZF antibody: synthetic peptide directed towards the middle region of human CREBZF. Synthetic peptide located within the following region: AAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEES |
Active filters
Target Symbol
- ZHANGFEI
Conjugates
- Unconjugated