Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TRIM29 mouse monoclonal antibody,clone OTI5C11
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TRIM29 mouse monoclonal antibody,clone OTI8D12
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-ATDC antibody
| Applications | WB |
| Reactivities | Human, Bovine, Chimpanzee, Macaque, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit polyclonal ATDC Ac-K116 antibody
| Applications | WB |
| Reactivities | Human, Bovine, Chimpanzee, Macaque, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit polyclonal TRIM29 Antibody (Center)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This TRIM29 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human TRIM29. |
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: HKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKS |
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the N terminal of human TRIM29. Synthetic peptide located within the following region: EAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAA |
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: SLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP |
TRIM29 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM29 |
Active filters
Target Symbol
- TRIM29
Conjugates
- Unconjugated