Rabbit Polyclonal Anti-FAM29A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM29A antibody: synthetic peptide directed towards the middle region of human FAM29A. Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT |
Rabbit Polyclonal Anti-FAM29A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM29A antibody: synthetic peptide directed towards the middle region of human FAM29A. Synthetic peptide located within the following region: DFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTD |
Germany
Japan
United Kingdom
China