Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ECT2 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ECT2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 565-594 amino acids from the Central region of Human ECT2. |
Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Chimpanzee, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ECT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL |
Rabbit Polyclonal Anti-ECT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECT2 antibody: synthetic peptide directed towards the middle region of human ECT2. Synthetic peptide located within the following region: KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG |
ECT2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human ECT2 |
ECT2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ECT2. |
| Modifications | Unmodified |
ECT2 (N-term) goat polyclonal antibody, Aff - Purified
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide from N Terminus of the protein sequence according to NP_060568.3. |
Active filters
Target Symbol
- ECT2
Conjugates
- Unconjugated