Rabbit Polyclonal Anti-CPSF4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CPSF4 |
Rabbit Polyclonal Anti-CPSF4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CPSF4 |
Rabbit Polyclonal Anti-CPSF4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CPSF4 |
CPSF30 (CPSF4) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 96~123 amino acids from the Central region of Human CPSF4. |
Rabbit Polyclonal Anti-CPSF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPSF4 antibody: synthetic peptide directed towards the C terminal of human CPSF4. Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK |