Antibodies

View as table Download

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPSF4

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPSF4

CPSF30 (CPSF4) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 96~123 amino acids from the Central region of Human CPSF4.

Rabbit Polyclonal Anti-CPSF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPSF4 antibody: synthetic peptide directed towards the C terminal of human CPSF4. Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK