Antibodies

Jump to Filters
View as table Download
STAC2 Rabbit Polyclonal Antibody
TA316362

USD 380.00

In Stock

Rabbit polyclonal anti-STAC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STAC2.
STAC2 Rabbit Polyclonal Antibody
TA334863

USD 539.00

5 Days

Rabbit Polyclonal Anti-STAC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAC2 antibody is: synthetic peptide directed towards the N-terminal region of Human STAC2. Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN