Antibodies

Jump to Filters
View as table Download
BMP8A Rabbit Polyclonal Antibody
TA383822

USD 380.00

4 Weeks

BMP8A Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human BMP8A. AA range:241-290
BMP8A Rabbit Polyclonal Antibody
AP01386PU-N

USD 445.00

3 Weeks

BMP8A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
BMP8A Rabbit Polyclonal Antibody
TA316388

USD 380.00

In Stock

Rabbit polyclonal anti-BMP8A antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human BMP8A.
BMP8A Rabbit Polyclonal Antibody
TA337727

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG
BMP8A Rabbit Polyclonal Antibody
TA337728

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8A. Synthetic peptide located within the following region: RPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPL
BMP8A Rabbit Polyclonal Antibody
TA358916

USD 539.00

5 Days

BMP8A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human BMP8A