Antibodies

View as table Download

TYK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TYK2

TYK2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TYK2

TYK2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal antibody to TYK2 (tyrosine kinase 2)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 680 and 1187 of TYK2 (Uniprot ID#P29597)

TYK2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 750-850 of human TYK2 (NP_003322.3).
Modifications Unmodified

TYK2 mouse monoclonal antibody, clone 8G8E9, Ascites

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

TYK2 pTyr1054 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R).

Rabbit anti-TYK2 (Phospho-Tyr1054) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanTYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R).
Modifications Phospho-specific

Rabbit Polyclonal TYK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal TYK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TYK2.

Rabbit Polyclonal anti-TYK2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP

Rabbit Polyclonal Anti-TYK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYK2 Antibody: A synthesized peptide derived from human TYK2

TYK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TYK2