Antibodies

Jump to Filters
View as table Download
TCTN3 Rabbit Polyclonal Antibody
TA319883

USD 570.00

5 Days

Rabbit Polyclonal TCTN3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TCTN3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TCTN3.
TCTN3 Rabbit Polyclonal Antibody
TA335587

USD 539.00

5 Days

Rabbit Polyclonal Anti-TCTN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCTN3 Antibody: synthetic peptide directed towards the middle region of human TCTN3. Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS