Antibodies

View as table Download

LRRC23 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRRC23

LRRC23 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRRC23

Rabbit Polyclonal Anti-LRRC23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC23 antibody: synthetic peptide directed towards the N terminal of human LRRC23. Synthetic peptide located within the following region: LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN

Rabbit Polyclonal Anti-LRRC23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC23 antibody: synthetic peptide directed towards the middle region of human LRRC23. Synthetic peptide located within the following region: ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH