GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)
Applications | IHC, WB |
Reactivities | Human (Predicted: Cow) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217) |
GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-GSTA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTA4 antibody: synthetic peptide directed towards the C terminal of human GSTA4. Synthetic peptide located within the following region: LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
GSTA4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-GSTA4 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".