Antibodies

View as table Download

Rabbit Polyclonal DLK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1.

DLK (DLK1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of Human DLK

Rabbit Polyclonal Anti-DLK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT