Rabbit Polyclonal DLK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1. |
Rabbit Polyclonal DLK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DLK1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DLK1. |
DLK (DLK1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of Human DLK |
Rabbit Polyclonal Anti-DLK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |