Antibodies

Jump to Filters
View as table Download
MYL9 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
TA813394

USD 447.00

In Stock

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MYL9 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF813394

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MYL9 Rabbit Polyclonal Antibody
TA322531

USD 380.00

In Stock

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory
MYL9 Rabbit Polyclonal Antibody
TA322532

USD 380.00

In Stock

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory
MYL9 Rabbit Polyclonal Antibody
TA346605

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF
MYL9 (C-term) Rabbit Polyclonal Antibody
AP52791PU-N

USD 580.00

2 Weeks

MYL9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 95-125aa) of human MYL9