Rabbit Polyclonal antibody to Edc3 (enhancer of mRNA decapping 3 homolog (S. cerevisiae))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 127 and 376 of Edc3 (Uniprot ID#Q96F86) |
Rabbit Polyclonal Anti-EDC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDC3 antibody is: synthetic peptide directed towards the middle region of Human EDC3. Synthetic peptide located within the following region: KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT |
Germany
Japan
United Kingdom
China
