Antibodies

View as table Download

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal anti-EDG8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDG8 antibody: synthetic peptide directed towards the N terminal of human EDG8. Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Anti-S1PR5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-39 amino acids of human sphingosine-1-phosphate receptor 5

Rabbit Polyclonal Anti-S1PR5 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen S1PR5 / EDG8 / S1P5 antibody was raised against synthetic 18 amino acid peptide from 2nd cytoplasmic domain of human S1PR5 / EDG8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Marmoset (89%); Mouse, Rat, Hamster, Dog, Bat (83%).