Antibodies

Jump to Filters
View as table Download
COQ6 (N-term) Rabbit Polyclonal Antibody
AP51027PU-N

USD 580.00

2 Weeks

COQ6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of human COQ6
COQ6 Rabbit Polyclonal Antibody
TA337726

USD 539.00

5 Days

Rabbit Polyclonal Anti-COQ6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COQ6 antibody is: synthetic peptide directed towards the N-terminal region of Human COQ6. Synthetic peptide located within the following region: ILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRA
COQ6 Rabbit Polyclonal Antibody
TA358646

USD 539.00

5 Days

COQ6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated