Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK12 mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAPK12 |
Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Anti-Mapk12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE |