Antibodies

Jump to Filters
View as table Download
GNRH2 (Center) Rabbit Polyclonal Antibody
AP51886PU-N

USD 580.00

2 Weeks

GNRH2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 32~62 amino acids from the Central region of human GNRH2 / Progonadoliberin-2
GNRH2 Rabbit Polyclonal Antibody
TA357265

USD 539.00

5 Days

GNRH2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV