Antibodies

Jump to Filters
View as table Download
GMP Synthase (GMPS) (Center) Rabbit Polyclonal Antibody
AP18037PU-N

USD 580.00

2 Weeks

GMP Synthase (GMPS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GMPS
GMP Synthase (GMPS) (C-term) Rabbit Polyclonal Antibody
AP18038PU-N

USD 580.00

2 Weeks

GMP Synthase (GMPS) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human GMPS
GMP Synthase (GMPS) Rabbit Polyclonal Antibody
TA346719

USD 539.00

5 Days

Rabbit Polyclonal Anti-GMPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA