Antibodies

Jump to Filters
View as table Download
CES2 (Center) Rabbit Polyclonal Antibody
AP50867PU-N

USD 580.00

2 Weeks

CES2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 343-373 amino acids from the Central region of human CES2
CES2 Rabbit Polyclonal Antibody
TA346369

USD 539.00

5 Days

Rabbit Polyclonal Anti-CES2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the C terminal of human CES2. Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
CES2 Rabbit Polyclonal Antibody
TA321606

USD 380.00

In Stock

Anti-CES2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 355-369 amino acids of human carboxylesterase 2
CES2 Rabbit Polyclonal Antibody
TA327057

USD 365.00

3 Weeks

Rabbit anti-CES2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CES2
CES2 Rabbit Polyclonal Antibody
TA314814

USD 380.00

4 Weeks

Rabbit polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CES2.
CES2 Rabbit Polyclonal Antibody
TA329519

USD 539.00

5 Days

Rabbit Polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the middle region of human CES2. Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG