Antibodies

Jump to Filters
View as table Download
POLR3B Rabbit Polyclonal Antibody
TA315598

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPC2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC2.
POLR3B Rabbit Polyclonal Antibody
TA346793

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED