Antibodies

View as table Download

PTGES2 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTGES2 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

PTGES2 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2

Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)

Applications WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7)

Rabbit Polyclonal Anti-PTGES2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN

Rabbit Polyclonal Anti-PTGES2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG