Antibodies

Jump to Filters
View as table Download
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF501418

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Rabbit Polyclonal Antibody
TA308453

USD 625.00

5 Days

Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613)
Pyruvate Kinase (PKLR) Rabbit Polyclonal Antibody
TA346172

USD 485.00

5 Days

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA501413S

USD 200.00

2 Days

PKLR mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
TA501412S

USD 200.00

2 Days

Anti-PKLR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
TA501414S

USD 200.00

2 Days

Anti-PKLR mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H2]
TA501416S

USD 200.00

2 Days

Anti-PKLR mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1C7]
TA501472S

USD 200.00

2 Days

PKLR mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
TA501417S

USD 200.00

2 Days

Anti-PKLR mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA501411S

USD 200.00

2 Days

PKLR mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".