Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613) |
Rabbit Polyclonal Anti-PKLR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Pyruvate Kinase (PKLR) mouse monoclonal antibody, clone AT1E3, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Pyruvate Kinase (PKLR) mouse monoclonal antibody, clone AT1E3, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PKLR mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PKLR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PKLR mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PKLR mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PKLR mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PKLR mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PKLR mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".