Rabbit Polyclonal Anti-ANO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANO1 |
Rabbit Polyclonal Anti-ANO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANO1 |
Rabbit Polyclonal Anti-TMEM16A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
Rabbit Polyclonal TMEM16A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TMEM16A antibody was raised against a 17 amino acid peptide from near the amino terminus of human TMEM16A. |
Rabbit Polyclonal DOG1/TMEM16A Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ANO1 / TM16A antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TM16A. |