Antibodies

Jump to Filters
View as table Download
FCER1G Rabbit Polyclonal Antibody
TA339393

USD 539.00

5 Days

Rabbit Polyclonal Anti-FCER1G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV
FCER1G Rabbit Polyclonal Antibody
TA376178

USD 365.00

3 Weeks

FCER1G Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1).
Modifications Unmodified