Antibodies

View as table Download

EBF3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EBF3

EBF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EBF3

Rabbit Polyclonal anti-EBF3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF3 antibody: synthetic peptide directed towards the middle region of human EBF3. Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ

EBF3 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1).
Modifications Unmodified