Antibodies

Jump to Filters
View as table Download
CTBP2 Rabbit Polyclonal Antibody
TA323303

USD 380.00

In Stock

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2
CTBP2 Rabbit Polyclonal Antibody
TA351113

USD 380.00

In Stock

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTBP2
CTBP2 Rabbit Polyclonal Antibody
TA339752

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA
CTBP2 Rabbit Polyclonal Antibody
TA323302

USD 380.00

In Stock

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2
CTBP2 Rabbit Polyclonal Antibody
TA339753

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE
CTBP2 Rabbit Polyclonal Antibody
TA375182

USD 365.00

3 Weeks

CTBP2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CTBP2 (NP_001320.1).
CTBP2 Rabbit Polyclonal Antibody
TA307965

USD 625.00

5 Days

Rabbit Polyclonal antibody to CtBP2 (C-terminal binding protein 2)

Applications IF, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 197 and 417 of CtBP2 (Uniprot ID#P56545)
CTBP2 Rabbit Polyclonal Antibody
TA375183

USD 365.00

3 Weeks

CTBP2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CTBP2 (NP_001320.1).
Modifications Unmodified
CTBP2 Rabbit Polyclonal Antibody
TA313709

USD 380.00

4 Weeks

Rabbit polyclonal anti-CtBP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CtBP2.