Antibodies

View as table Download

PPARG rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPARG

PPAR gamma Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PPAR-gamma. AA range:78-127

PPARγ Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-170 of human PPARγ (NP_056953.2).
Modifications Unmodified

PPAR gamma Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein

PPAR-gama polyclonal antibody

Applications IF, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human PPAR-gama.

Rabbit Polyclonal Anti-Pparg Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pparg antibody is: synthetic peptide directed towards the C-terminal region of Rat Pparg. Synthetic peptide located within the following region: HPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYK

PPARG (Phospho-T166) polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human PPARG around the phosphorylation site of Threonine 166.

PPAR gamma (PPARG) (Isoform 1) rabbit polyclonal antibody, Purified

Applications ELISA
Reactivities Canine, Guinea Pig, Hamster, Human, Mink, Monkey, Mouse, Rabbit, Rat, Duck
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 255 - 268 of human PPAR gamma isoform 1.