Goat Polyclonal Antibody against DEAD-box protein 6
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1. |
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL |
Rabbit Polyclonal Anti-DDX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ |
Germany
Japan
United Kingdom
China