Antibodies

Jump to Filters
View as table Download
TBKBP1 Rabbit Polyclonal Antibody
TA306842

USD 570.00

5 Days

Rabbit Polyclonal Prosapip2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Prosapip2 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human Prosapip2.
TBKBP1 Rabbit Polyclonal Antibody
TA331972

USD 539.00

5 Days

Rabbit Polyclonal Anti-TBKBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBKBP1 Antibody is: synthetic peptide directed towards the N-terminal region of Human TBKBP1. Synthetic peptide located within the following region: ELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGL