Antibodies

Jump to Filters
View as table Download
SLC27A4 Rabbit Polyclonal Antibody
TA315134

USD 380.00

In Stock

Rabbit polyclonal anti-SLC27A4 antibody

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC27A4.
SLC27A4 Rabbit Polyclonal Antibody
TA333949

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC27A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A4 Antibody: synthetic peptide directed towards the middle region of human SLC27A4. Synthetic peptide located within the following region: YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL