Antibodies

Jump to Filters
View as table Download
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351515

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303218

USD 520.00

5 Days

Goat Polyclonal Antibody against PLIN

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351513

USD 380.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA351514

USD 380.00

In Stock

Rabbit Polyclonal Anti-PLIN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLIN1
Perilipin-1 (PLIN1) Goat Polyclonal Antibody
TA303219

USD 520.00

5 Days

Goat Polyclonal Antibody against PLIN (C-terminal)

Applications WB
Reactivities Human (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2.
Perilipin-1 (PLIN1) Rabbit Polyclonal Antibody
TA346328

USD 485.00

5 Days

Rabbit Polyclonal Anti-PLIN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS