Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 2 of 2 results

(reset)

FATP2 (SLC27A2) Rabbit Polyclonal Antibody

TA333990

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

FATP2 (SLC27A2) Rabbit Polyclonal Antibody

TA350424

USD 380.00

In Stock

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human SLC27A2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 2 of 2 results