Antibodies

Jump to Filters
View as table Download
GLUR3 (GRIA3) Rabbit Polyclonal Antibody
TA322430

USD 380.00

In Stock

Anti-GRIA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-302 amino acids of Human glutamate receptor, ionotropic, AMPA 3
GLUR3 (GRIA3) Rabbit Polyclonal Antibody
TA322429

USD 380.00

In Stock

Anti-GRIA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-302 amino acids of Human glutamate receptor, ionotropic, AMPA 3
GLUR3 (GRIA3) Rabbit Polyclonal Antibody
TA338509

USD 539.00

5 Days

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM