Goat Anti-RAB23 Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNKQRTKKNRNP, from the C Terminus of the protein sequence according to NP_057361.3; NP_899050.1. |
Rabbit Polyclonal Anti-RAB23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB23 antibody: synthetic peptide directed towards the N terminal of human RAB23. Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA |
Germany
Japan
United Kingdom
China