Antibodies

Jump to Filters
View as table Download
EDA Rabbit Polyclonal Antibody
TA327440

USD 365.00

3 Weeks

EDA Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human EDA
EDA Rabbit Polyclonal Antibody
TA336167

USD 539.00

5 Days

Rabbit Polyclonal Anti-Eda Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Eda Antibody is: synthetic peptide directed towards the C-terminal region of Rat Eda. Synthetic peptide located within the following region: FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH